PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_010741-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 303aa    MW: 34393.4 Da    PI: 7.0945
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_010741-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l ++v  +G g+W++++r  g++R++k+c++rw +yl
    NNU_010741-RA 14 RGLWSPEEDEKLFNYVSTHGHGCWSSVPRLAGLRRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding43.67e-1467109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg  + +E +l++++++ lG++ W+ Ia++++ gRt++++k++w+
    NNU_010741-RA  67 RGHLSSQETDLIIQLHRVLGNR-WAQIAKYLP-GRTDNEVKNFWN 109
                      5667899***************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-25663IPR009057Homeodomain-like
PROSITE profilePS5129425.278965IPR017930Myb domain
SuperFamilySSF466894.12E-2911108IPR009057Homeodomain-like
SMARTSM007171.7E-141363IPR001005SANT/Myb domain
PfamPF002492.5E-161461IPR001005SANT/Myb domain
CDDcd001675.53E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2264117IPR009057Homeodomain-like
PROSITE profilePS5129418.14766116IPR017930Myb domain
SMARTSM007173.4E-1366114IPR001005SANT/Myb domain
PfamPF002491.4E-1267110IPR001005SANT/Myb domain
CDDcd001673.90E-1071109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLFNYVS THGHGCWSSV PRLAGLRRCG KSCRLRWINY  60
LRPDLKRGHL SSQETDLIIQ LHRVLGNRWA QIAKYLPGRT DNEVKNFWNS SIKKKLISGA  120
TVSVDLTTLS DVWNPVASRE GLLSLNANPD PTVAGQQRHF CLPQQTTKLA SYDDGDFEPD  180
MIDYDVNWIS VSQPQPLQTE TTDSCDLMPT ESCGYSIRHH HGHRYRPSEN YQDYSQTDEA  240
TTAYDGQLLG SEIPNMDKCG IPSSSALHET TEPFTAFPSS ACFPFRSYPW NPQMPTNQRQ  300
CIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4765816e-38AM476581.2 Vitis vinifera contig VV78X241396.15, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262063.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A061GC449e-95A0A061GC44_THECC; MYB7
STRINGVIT_09s0002g01670.t012e-85(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.28e-73myb domain protein 26